Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PGLYRP4 Peptide - N-terminal region

PGLYRP4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

PGLYRPIbeta, PGRP-Ibeta, PGRPIB, SBBI67

UniProt

Q96LB8

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PGLYRP4 Rabbit Polyclonal Antibody (orb586636) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_065126

Preservative

Lyophilized powder

AA Sequence

LGIQAWGDSSWNKTQAKQVSEGLQYLFENISQLTEKGLPTDVSTTVSRKA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Villin1 Recombinant Rabbit Monoclonal Antibody [C4]
HA721129 100 µL

Villin1 Recombinant Rabbit Monoclonal Antibody [C4]

Sign In for Pricing
View Details
RBBP5 Rabbit Polyclonal Antibody
TA380754 100 µL

RBBP5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
LIFR Antibody
KC-8291-01 50 μL

LIFR Antibody

Sign In for Pricing
View Details
LIFR Antibody
KC-8291-02 100 µL

LIFR Antibody

Sign In for Pricing
View Details
LIFR Antibody
KC-8291-03 1 mL

LIFR Antibody

Sign In for Pricing
View Details
APC / Adenomatous Polyposis Coli / FAP (Tumor Suppressor) (ALi 12-28), CF568 conjugate, 0.1mg/mL
BNC683076-500 1x 500 µL

APC / Adenomatous Polyposis Coli / FAP (Tumor Suppressor) (ALi 12-28), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details