Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIF24 Peptide - N-terminal region

KIF24 Peptide - N-terminal region

Product Specifications

Product Name Alternative

C9orf48, FLJ10933, FLJ43884, MGC125677, MGC125678, bA571F15.4

UniProt

Q5T7B8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KIF24 Rabbit Polyclonal Antibody (orb586694) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_919289

Preservative

Lyophilized powder

AA Sequence

IRQNTSEKQNPWTEMEKIRVCVRKRPLGMREVRRGEINIITVEDKETLLV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant NEK4 Antibody
RC-4573-01 50 μL

Recombinant NEK4 Antibody

Sign In for Pricing
View Details
Recombinant NEK4 Antibody
RC-4573-02 100 µL

Recombinant NEK4 Antibody

Sign In for Pricing
View Details
Recombinant NEK4 Antibody
RC-4573-03 1 mL

Recombinant NEK4 Antibody

Sign In for Pricing
View Details
(1R,2S) Metconazole-5-one
TRC-M418080-25MG 25 mg

(1R,2S) Metconazole-5-one

Sign In for Pricing
View Details
ACAD10 Human Gene Knockout Kit (CRISPR)
KN418001 1 Kit

ACAD10 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Integrin alpha-2 Antibody (Biotin)
KB-3664-01 50 μL

Integrin alpha-2 Antibody (Biotin)

Sign In for Pricing
View Details