Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VASN Peptide - C-terminal region

VASN Peptide - C-terminal region

Product Specifications

Product Name Alternative

SLITL2

UniProt

Q6EMK4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with VASN Rabbit Polyclonal Antibody (orb586760) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_612449

Preservative

Lyophilized powder

AA Sequence

TVTQLRPNATYSVCVMPLGPGRVPEGEEACGEAHTPPAVHSNHAPVTQAR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Urocortin 3 (UCN3) (NM_053049) Human Tagged Lenti ORF Clone
RC215733L3 10 µg

Urocortin 3 (UCN3) (NM_053049) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Armcx1 ORF Vector (Mouse) (pORF)
ORF039070 1.0 µg DNA

Armcx1 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
ZYX siRNA (Human)
MBS8236975-01 15 nmol

ZYX siRNA (Human)

Sign In for Pricing
View Details
ZYX siRNA (Human)
MBS8236975-02 30 nmol

ZYX siRNA (Human)

Sign In for Pricing
View Details
ZYX siRNA (Human)
MBS8236975-03 5x 30 nmol

ZYX siRNA (Human)

Sign In for Pricing
View Details
Mouse Monoclonal PNMA3 Antibody (OTI2E6) [Janelia Fluor 646]
NBP2-73487JF646 0.1 mL

Mouse Monoclonal PNMA3 Antibody (OTI2E6) [Janelia Fluor 646]

Sign In for Pricing
View Details