Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VASN Peptide - C-terminal region

VASN Peptide - C-terminal region

Product Specifications

Product Name Alternative

SLITL2

UniProt

Q6EMK4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with VASN Rabbit Polyclonal Antibody (orb586760) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_612449

Preservative

Lyophilized powder

AA Sequence

TVTQLRPNATYSVCVMPLGPGRVPEGEEACGEAHTPPAVHSNHAPVTQAR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tau antibody
20R-1969 0.05 mg

Tau antibody

Sign In for Pricing
View Details
Dynein axonemal assembly factor 5 Antibody (HRP)
orb3157483 100 µg

Dynein axonemal assembly factor 5 Antibody (HRP)

Sign In for Pricing
View Details
Recombinant Human NPAS2 Protein - (Dry Ice)
H00004862-P01-25ug 25 µg

Recombinant Human NPAS2 Protein - (Dry Ice)

Sign In for Pricing
View Details
BAIAP2L1 Protein Vector (Rat) (pPB-N-His)
PV255807 500 ng

BAIAP2L1 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
RGD1562114 sgRNA CRISPR Lentivector (Rat) (Target 3)
K6024904 1.0 µg DNA

RGD1562114 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
ENDOD1 Knockout HT29 Polyclonal Cells
ARG14316 1 Million

ENDOD1 Knockout HT29 Polyclonal Cells

Sign In for Pricing
View Details