Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLET1 Peptide - middle region

PLET1 Peptide - middle region

Product Specifications

Product Name Alternative

C11orf34

UniProt

Q6UQ28

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PLET1 Rabbit Polyclonal Antibody (orb326660) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001138496

Preservative

Lyophilized powder

AA Sequence

NSDSAGLWQRADKNCYSNSTYYVKDQYMTVLEAQWQAPEPENITEVEIQA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

delta4-Androstene-3alpha,17beta-diol
TRC-A637480-25MG 25 mg

delta4-Androstene-3alpha,17beta-diol

Sign In for Pricing
View Details
CD105 Antibody
KC-3807-01 50 μL

CD105 Antibody

Sign In for Pricing
View Details
CD105 Antibody
KC-3807-02 100 µL

CD105 Antibody

Sign In for Pricing
View Details
CD105 Antibody
KC-3807-03 1 mL

CD105 Antibody

Sign In for Pricing
View Details
Northebaine Hydrochloride
TRC-N826503-25MG 25 mg

Northebaine Hydrochloride

Sign In for Pricing
View Details
ARPP19 (NM_006628) Human Over-expression Lysate
LY401981 100 µg

ARPP19 (NM_006628) Human Over-expression Lysate

Sign In for Pricing
View Details