Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLET1 Peptide - middle region

PLET1 Peptide - middle region

Product Specifications

Product Name Alternative

C11orf34

UniProt

Q6UQ28

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PLET1 Rabbit Polyclonal Antibody (orb326660) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001138496

Preservative

Lyophilized powder

AA Sequence

NSDSAGLWQRADKNCYSNSTYYVKDQYMTVLEAQWQAPEPENITEVEIQA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45RB (BRA-11G), CF405S conjugate, 0.1mg/mL
BNC040174-100 1x 100 µL

CD45RB (BRA-11G), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TSEN34 (NM_001282332) Human Tagged ORF Clone
RG237365 10 µg

TSEN34 (NM_001282332) Human Tagged ORF Clone

Sign In for Pricing
View Details
(+/-)-1,4-Diazabicyclo[4.4.0]decane
TRC-D417580-250MG 250 mg

(+/-)-1,4-Diazabicyclo[4.4.0]decane

Sign In for Pricing
View Details
Feruloylputrescine Trifluoroacetic Acid Salt
TRC-F308950-250MG 250 mg

Feruloylputrescine Trifluoroacetic Acid Salt

Sign In for Pricing
View Details
TPH2 Recombinant Chimeric Antibody Antibody
HA601494 100 µL

TPH2 Recombinant Chimeric Antibody Antibody

Sign In for Pricing
View Details
Recombinant Human TGF beta 1 protein (His Tag)
PKSH034147-01 20 µg

Recombinant Human TGF beta 1 protein (His Tag)

Sign In for Pricing
View Details