CDC42SE2 Peptide - middle region
CDC42SE2 Peptide - middle region
Product Specifications
Product Name Alternative
FLJ21967, SPEC2
UniProt
Q9NRR3
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CDC42SE2 Rabbit Polyclonal Antibody (orb326663) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_064625
Preservative
Lyophilized powder
AA Sequence
NFVHTAHVGSGDLFSGMNSVSSIQNQMQSKGGYGGGMPANVQMQLVDTKA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MR222985L3V 200 µL
BC048679 (NM_001193274) Mouse Tagged ORF Clone Lentiviral Particle
Sign In for Pricing
View Details 
038051-APC 200 µL
MACOI, NT (TMEM57, Macoilin, Transmembrane protein 57) (APC) discontinued
Sign In for Pricing
View Details 
484750 100 µL
LHCGR (Lutropin-Choriogonadotropic Hormone Receptor, Luteinizing Hormone/Choriogonadotropin Receptor)
Sign In for Pricing
View Details