Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDC42SE2 Peptide - middle region

CDC42SE2 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ21967, SPEC2

UniProt

Q9NRR3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CDC42SE2 Rabbit Polyclonal Antibody (orb326663) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_064625

Preservative

Lyophilized powder

AA Sequence

NFVHTAHVGSGDLFSGMNSVSSIQNQMQSKGGYGGGMPANVQMQLVDTKA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GAGE12B Human shRNA Plasmid Kit (Locus ID 729428)
TL321207 1 Kit

GAGE12B Human shRNA Plasmid Kit (Locus ID 729428)

Sign In for Pricing
View Details
CCL22 Antibody Pair
CSB-EAP05895 1 Pair (5x 96 Well Plates)

CCL22 Antibody Pair

Sign In for Pricing
View Details
OPCA05199-500UG - PSAP Recombinant Protein (Human)
OPCA05199-500UG 500 µg

OPCA05199-500UG - PSAP Recombinant Protein (Human)

Sign In for Pricing
View Details
Human/Mouse/Rat BDNF protein
MBS9719461-01 0.005 mg

Human/Mouse/Rat BDNF protein

Sign In for Pricing
View Details
Human/Mouse/Rat BDNF protein
MBS9719461-02 0.02 mg

Human/Mouse/Rat BDNF protein

Sign In for Pricing
View Details
Human/Mouse/Rat BDNF protein
MBS9719461-03 0.1 mg

Human/Mouse/Rat BDNF protein

Sign In for Pricing
View Details