Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYP4F22 Peptide - middle region

CYP4F22 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ39501, LI3

UniProt

Q6NT55

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CYP4F22 Rabbit Polyclonal Antibody (orb586788) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_775754

Preservative

Lyophilized powder

AA Sequence

TLDSLQKCVFSYNSNCQEKMSDYISAIIELSALSVRRQYRLHHYLDFIYY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSPA1A Antibody
KC-1254-01 50 μL

HSPA1A Antibody

Sign In for Pricing
View Details
HSPA1A Antibody
KC-1254-02 100 µL

HSPA1A Antibody

Sign In for Pricing
View Details
HSPA1A Antibody
KC-1254-03 1 mL

HSPA1A Antibody

Sign In for Pricing
View Details
Majin Mouse Gene Knockout Kit (CRISPR)
KN500175 1 Kit

Majin Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CAPON (NOS1AP) (NM_001126060) Human Over-expression Lysate
LY426640 100 µg

CAPON (NOS1AP) (NM_001126060) Human Over-expression Lysate

Sign In for Pricing
View Details
IGFBP6 (C-term) Rabbit Polyclonal Antibody
AP17495PU-N 400 µL

IGFBP6 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details