Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYP4F22 Peptide - middle region

CYP4F22 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ39501, LI3

UniProt

Q6NT55

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CYP4F22 Rabbit Polyclonal Antibody (orb586788) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_775754

Preservative

Lyophilized powder

AA Sequence

TLDSLQKCVFSYNSNCQEKMSDYISAIIELSALSVRRQYRLHHYLDFIYY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (CRIS-7), 1mg/mL
BNUM1050-50 1x 50 µL

CD3e (CRIS-7), 1mg/mL

Sign In for Pricing
View Details
Orbital Shaker BSOT-603
BSOT-603 Each

Orbital Shaker BSOT-603

Sign In for Pricing
View Details
SAMSN1 (NM_022136) Human Over-expression Lysate
LC402912 20 µg

SAMSN1 (NM_022136) Human Over-expression Lysate

Sign In for Pricing
View Details
TMEM51 (NM_001136216) Human Over-expression Lysate
LC427856 20 µg

TMEM51 (NM_001136216) Human Over-expression Lysate

Sign In for Pricing
View Details
PDE9A (NM_001001568) Human Over-expression Lysate
LY424385 100 µg

PDE9A (NM_001001568) Human Over-expression Lysate

Sign In for Pricing
View Details
S100B (4C4.9), CF740 conjugate, 0.1mg/mL
BNC740143-500 1x 500 µL

S100B (4C4.9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details