Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GNG4 Peptide - middle region

GNG4 Peptide - middle region

Product Specifications

Product Name Alternative

DKFZp547K1018, FLJ23803, FLJ34187

UniProt

P50150

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GNG4 Rabbit Polyclonal Antibody (orb326668) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004476

Preservative

Lyophilized powder

AA Sequence

EACMDRVKVSQAAADLLAYCEAHVREDPLIIPVPASENPFREKKFFCTIL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PerCP/Cyanine5.5 Anti-Human CD27 Antibody
JOT21735F 20Tests

PerCP/Cyanine5.5 Anti-Human CD27 Antibody

Sign In for Pricing
View Details
Chlamydia/Neisseria gonorrhoeae TaqMan Probe/Primer and Control Set
TM42510 100 Reactions

Chlamydia/Neisseria gonorrhoeae TaqMan Probe/Primer and Control Set

Sign In for Pricing
View Details
LDHB Antibody
PT-A03268-01 5 µg

LDHB Antibody

Sign In for Pricing
View Details
LDHB Antibody
PT-A03268-02 20 µg

LDHB Antibody

Sign In for Pricing
View Details
LDHB Antibody
PT-A03268-03 100 µg

LDHB Antibody

Sign In for Pricing
View Details
Ferret IL6
117021 100 µg

Ferret IL6

Sign In for Pricing
View Details