Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR25 Peptide - middle region

GPR25 Peptide - middle region

Product Specifications

UniProt

O00155

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GPR25 Rabbit Polyclonal Antibody (orb586808) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005289

Preservative

Lyophilized powder

AA Sequence

VALLAGLPSLVYRGLQPLPGGQDSQCGEEPSHAFQGLSLLLLLLTFVLPL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC30A2 (NM_001004434) Human Over-expression Lysate
LY423751 100 µg

SLC30A2 (NM_001004434) Human Over-expression Lysate

Sign In for Pricing
View Details
Mieshuan
TRC-M343800-250MG 250 mg

Mieshuan

Sign In for Pricing
View Details
CD47 (IAP/964), 1mg/mL
BNUM0964-50 1x 50 µL

CD47 (IAP/964), 1mg/mL

Sign In for Pricing
View Details
INPPL1 Polyclonal Antibody
E-AB-16523-01 20 µL

INPPL1 Polyclonal Antibody

Sign In for Pricing
View Details
INPPL1 Polyclonal Antibody
E-AB-16523-02 60 µL

INPPL1 Polyclonal Antibody

Sign In for Pricing
View Details
INPPL1 Polyclonal Antibody
E-AB-16523-03 120 µL

INPPL1 Polyclonal Antibody

Sign In for Pricing
View Details