Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR25 Peptide - middle region

GPR25 Peptide - middle region

Product Specifications

UniProt

O00155

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GPR25 Rabbit Polyclonal Antibody (orb586808) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005289

Preservative

Lyophilized powder

AA Sequence

VALLAGLPSLVYRGLQPLPGGQDSQCGEEPSHAFQGLSLLLLLLTFVLPL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tmem204 Mouse Gene Knockout Kit (CRISPR)
KN517793 1 Kit

Tmem204 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DDX11 (Center) Rabbit Polyclonal Antibody
AP51215PU-N 400 µL

DDX11 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
POLDIP2 Human Gene Knockout Kit (CRISPR)
KN400053 1 Kit

POLDIP2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human TARS3 activation kit by CRISPRa
GA114807 1 Kit

Human TARS3 activation kit by CRISPRa

Sign In for Pricing
View Details
Tcea1 Mouse Gene Knockout Kit (CRISPR)
KN517302 1 Kit

Tcea1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PHACTR3 Recombinant Rabbit monoclonal Antibody
HA751047 100 µL

PHACTR3 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details