Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IGFL2 Peptide - C-terminal region

IGFL2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

UNQ645, VPRI645

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IGFL2 Rabbit Polyclonal Antibody (orb586820) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001002915

Preservative

Lyophilized powder

AA Sequence

QCGPPCTFWPCFELCCLDSFGLTNDFVVKLKVQGVNSQCHSSPISSKCES

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal DYKDDDDK Epitope Tag Antibody (F-tag-01) [CoraFluor 1]
NB500-554CL1 0.1 mL

Mouse Monoclonal DYKDDDDK Epitope Tag Antibody (F-tag-01) [CoraFluor 1]

Sign In for Pricing
View Details
PG-BE1
ARC0734 1 Million

PG-BE1

Sign In for Pricing
View Details
SERPINA10 (NM_001100607) Human Tagged ORF Clone Lentiviral Particle
RC218274L4V 200 µL

SERPINA10 (NM_001100607) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Olr237 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K7273308 1.0 µg DNA

Olr237 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
B30C-1125-595-OC Continuous Tapes for Printers
146042 1 Box (1 Roll x 1 Roll)

B30C-1125-595-OC Continuous Tapes for Printers

Sign In for Pricing
View Details
Recombinant HAdV-4 PIV Protein (aa 1-173)
VAng-Cr4307-1mgEcoli 1 mg (E. coli)

Recombinant HAdV-4 PIV Protein (aa 1-173)

Sign In for Pricing
View Details