Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IGFL2 Peptide - C-terminal region

IGFL2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

UNQ645, VPRI645

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IGFL2 Rabbit Polyclonal Antibody (orb586820) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001002915

Preservative

Lyophilized powder

AA Sequence

QCGPPCTFWPCFELCCLDSFGLTNDFVVKLKVQGVNSQCHSSPISSKCES

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

K1826 Rabbit Polyclonal Antibody (BF555)
orb2492043 100 µL

K1826 Rabbit Polyclonal Antibody (BF555)

Sign In for Pricing
View Details
FGF14 Rabbit pAb, PerCP-Cy7 conjugated
orb2871740 100 µL

FGF14 Rabbit pAb, PerCP-Cy7 conjugated

Sign In for Pricing
View Details
KLHL31 Polyclonal Antibody, RBITC Conjugated
bs-8057R-RBITC 100 µL

KLHL31 Polyclonal Antibody, RBITC Conjugated

Sign In for Pricing
View Details
NIA2 Polyclonal Antibody
E917328 100 µL

NIA2 Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral mouse Glrx2 shRNA (UAS) - Lentiviral mouse Glrx2 shRNA (UAS, iRFP) (25)
GTR15182210 1 Vial

Lentiviral mouse Glrx2 shRNA (UAS) - Lentiviral mouse Glrx2 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Nuclear distribution protein nudE-Like 1 (NDEL1) Rat ELISA Kit
F4528 96 Tests

Nuclear distribution protein nudE-Like 1 (NDEL1) Rat ELISA Kit

Sign In for Pricing
View Details