Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KDELR2 Peptide - C-terminal region

KDELR2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ELP-1, ERD2.2, FLJ45532

UniProt

P33947

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KDELR2 Rabbit Polyclonal Antibody (orb586832) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001094073

Preservative

Lyophilized powder

AA Sequence

ASVLQGARTEFLPQQRHKMLDTENQKLNSFVADSHQWLCKNAEEKSQKVS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Agarose LE, Ultra-Pure Molecular Biology Grade, 25 g
#41028-25G 1x 25 g

Agarose LE, Ultra-Pure Molecular Biology Grade, 25 g

Sign In for Pricing
View Details
Mouse CTGF (Connective Tissue Growth Factor) ELISA Kit
E-EL-M0340-01 24 Tests

Mouse CTGF (Connective Tissue Growth Factor) ELISA Kit

Sign In for Pricing
View Details
Mouse CTGF (Connective Tissue Growth Factor) ELISA Kit
E-EL-M0340-02 48 Tests

Mouse CTGF (Connective Tissue Growth Factor) ELISA Kit

Sign In for Pricing
View Details
Mouse CTGF (Connective Tissue Growth Factor) ELISA Kit
E-EL-M0340-03 96 Tests

Mouse CTGF (Connective Tissue Growth Factor) ELISA Kit

Sign In for Pricing
View Details
SOX18 Rabbit Monoclonal Antibody
TA422475 100 µL

SOX18 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant TUBA1B (phospho Y272) Antibody
RC-6502-01 50 μL

Recombinant TUBA1B (phospho Y272) Antibody

Sign In for Pricing
View Details