Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KDELR2 Peptide - C-terminal region

KDELR2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ELP-1, ERD2.2, FLJ45532

UniProt

P33947

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KDELR2 Rabbit Polyclonal Antibody (orb586832) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001094073

Preservative

Lyophilized powder

AA Sequence

ASVLQGARTEFLPQQRHKMLDTENQKLNSFVADSHQWLCKNAEEKSQKVS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HER-2 / CD340 (HRB2/451), Biotin conjugate, 0.1mg/mL
BNCB0451-100 1x 100 µL

HER-2 / CD340 (HRB2/451), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
b-Geranyl Acetate
TRC-G367210-25G 25 g

b-Geranyl Acetate

Sign In for Pricing
View Details
NDUFS1 Polyclonal Antibody
E-AB-11432-01 20 µL

NDUFS1 Polyclonal Antibody

Sign In for Pricing
View Details
NDUFS1 Polyclonal Antibody
E-AB-11432-02 60 µL

NDUFS1 Polyclonal Antibody

Sign In for Pricing
View Details
NDUFS1 Polyclonal Antibody
E-AB-11432-03 120 µL

NDUFS1 Polyclonal Antibody

Sign In for Pricing
View Details
NDUFS1 Polyclonal Antibody
E-AB-11432-04 200 µL

NDUFS1 Polyclonal Antibody

Sign In for Pricing
View Details