Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LCTL Peptide - N-terminal region

LCTL Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ33279, KLG, KLPH

UniProt

Q6UWM7

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LCTL Rabbit Polyclonal Antibody (orb586844) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_997221

Preservative

Lyophilized powder

AA Sequence

LLVPRLGAARKGSPEEASFYYGTFPLGFSWGVGSSAYQTEGAWDQDGKGP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C1orf64 Rabbit Polyclonal Antibody (Biotin)
orb448836 100 µL

C1orf64 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Rabbit IL17 ELISA kit
55R-2194 96 tests

Rabbit IL17 ELISA kit

Sign In for Pricing
View Details
Il1r1 Il1ra Protein (C-His, Rat)
P516066 100 µg

Il1r1 Il1ra Protein (C-His, Rat)

Sign In for Pricing
View Details
FSD2 Protein Lysate
OCOA16289-20UG 20 µg

FSD2 Protein Lysate

Sign In for Pricing
View Details
Uhmk1 sgRNA CRISPR Lentivector set (Rat)
K7308101 3x 1.0 µg

Uhmk1 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
BRD9 Protein Vector (Rat) (pPM-C-His)
PV256565 500 ng

BRD9 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details