Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LEPROTL1 Peptide - N-terminal region

LEPROTL1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

HSPC112, Vps55, my047

UniProt

O95214

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LEPROTL1 Rabbit Polyclonal Antibody (orb326676) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_056159

Preservative

Lyophilized powder

AA Sequence

FVLFFYILSPIPYCIARRLVDDTDAMSNACKELAIFLTTGIVVSAFGLPI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse mmu-miR-126a-3p miRNA Antagomir
abx887852-01 10 nmol

Mouse mmu-miR-126a-3p miRNA Antagomir

Sign In for Pricing
View Details
Mouse mmu-miR-126a-3p miRNA Antagomir
abx887852-02 20 nmol

Mouse mmu-miR-126a-3p miRNA Antagomir

Sign In for Pricing
View Details
Bovine Aftiphilin (AFTPH) ELISA kit
GTR10432666 96 Well

Bovine Aftiphilin (AFTPH) ELISA kit

Sign In for Pricing
View Details
Anti-Oncostatin M/Osm Antibody Picoband®, APC Conjugate
A00804-1-APC 100 µg/Vial

Anti-Oncostatin M/Osm Antibody Picoband®, APC Conjugate

Sign In for Pricing
View Details
Collagen Type V (HRP) discontinued
137871-HRP 100 µL

Collagen Type V (HRP) discontinued

Sign In for Pricing
View Details
HEY1 (BHLHb31, CHF2, HERP2, HESR1, HRT-1, MGC1274, OAF1)
470019 50 µg

HEY1 (BHLHb31, CHF2, HERP2, HESR1, HRT-1, MGC1274, OAF1)

Sign In for Pricing
View Details