Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAS1L Peptide - N-terminal region

MAS1L Peptide - N-terminal region

Product Specifications

Product Name Alternative

MAS-L, MGC119987, MRG, dJ994E9.2

UniProt

P35410

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MAS1L Rabbit Polyclonal Antibody (orb586848) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_443199

Preservative

Lyophilized powder

AA Sequence

WFSQRAGWTVFAESQISLSCSLCLHSGDQEAQNPNLVSQLCGVFLQNETN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glucose 6-Phosphate Isomerase (CPTC-GPI-1), CF405S conjugate, 0.1mg/mL
BNC042257-500 1x 500 µL

Glucose 6-Phosphate Isomerase (CPTC-GPI-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human SYDE2 activation kit by CRISPRa
GA113392 1 Kit

Human SYDE2 activation kit by CRISPRa

Sign In for Pricing
View Details
Human ORMDL3 activation kit by CRISPRa
GA114328 1 Kit

Human ORMDL3 activation kit by CRISPRa

Sign In for Pricing
View Details
Hexoprenaline Sulfate
TRC-H295463-50MG 50 mg

Hexoprenaline Sulfate

Sign In for Pricing
View Details
Paralemmin (PALM) (NM_002579) Human Over-expression Lysate
LY419238 100 µg

Paralemmin (PALM) (NM_002579) Human Over-expression Lysate

Sign In for Pricing
View Details
4-tert-Butyl-2-chlorophenol (Technical Grade)
TRC-B807038-1G 1 g

4-tert-Butyl-2-chlorophenol (Technical Grade)

Sign In for Pricing
View Details