Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MMP27 Peptide - middle region

MMP27 Peptide - middle region

Product Specifications

Product Name Alternative

MMP-27

UniProt

Q9H306

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MMP27 Rabbit Polyclonal Antibody (orb331373) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_071405

Preservative

Lyophilized powder

AA Sequence

GDTHFDEDENWTKDGAGFNLFLVAAHEFGHALGLSHSNDQTALMFPNYVS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat AMH (Anti-Mullerian Hormone) ELISA Kit
E-EL-R3022-01 24 Tests

Rat AMH (Anti-Mullerian Hormone) ELISA Kit

Sign In for Pricing
View Details
Rat AMH (Anti-Mullerian Hormone) ELISA Kit
E-EL-R3022-02 48 Tests

Rat AMH (Anti-Mullerian Hormone) ELISA Kit

Sign In for Pricing
View Details
Rat AMH (Anti-Mullerian Hormone) ELISA Kit
E-EL-R3022-03 96 Tests

Rat AMH (Anti-Mullerian Hormone) ELISA Kit

Sign In for Pricing
View Details
P2X3 Rabbit Polyclonal Antibody
ER1902-88 100 µL

P2X3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MBNL3 (NM_001170701) Human Over-expression Lysate
LY432854 100 µg

MBNL3 (NM_001170701) Human Over-expression Lysate

Sign In for Pricing
View Details
(2S)-2,6-Diisothiocyanato-Hexanoic Acid Ethyl Ester
TRC-D460723-100MG 100 mg

(2S)-2,6-Diisothiocyanato-Hexanoic Acid Ethyl Ester

Sign In for Pricing
View Details