Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MMP27 Peptide - middle region

MMP27 Peptide - middle region

Product Specifications

Product Name Alternative

MMP-27

UniProt

Q9H306

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MMP27 Rabbit Polyclonal Antibody (orb331373) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_071405

Preservative

Lyophilized powder

AA Sequence

GDTHFDEDENWTKDGAGFNLFLVAAHEFGHALGLSHSNDQTALMFPNYVS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse RETN Antibody Pair Set
E-KAB-0293 50 µL & 100 µg

Mouse RETN Antibody Pair Set

Sign In for Pricing
View Details
CD79a (JCB117 + HM47/A9), 0.2mg/mL
BNUB0828-100 1x 100 µL

CD79a (JCB117 + HM47/A9), 0.2mg/mL

Sign In for Pricing
View Details
Recombinant Human Cathepsin L/CTSL Protein (His Tag)
PKSH031573 50 µg

Recombinant Human Cathepsin L/CTSL Protein (His Tag)

Sign In for Pricing
View Details
CD50 (ICAM-3) (186-2G9), CF568 conjugate, 0.1mg/mL
BNC680178-100 1x 100 µL

CD50 (ICAM-3) (186-2G9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SHISAL2B Human Gene Knockout Kit (CRISPR)
KN428094 1 Kit

SHISAL2B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TNF alpha (J2D10), CF740 conjugate, 0.1mg/mL
BNC740994-100 1x 100 µL

TNF alpha (J2D10), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details