MRPL4 Peptide - N-terminal region
MRPL4 Peptide - N-terminal region
Product Specifications
Product Name Alternative
CDABP0091, CGI-28, L4mt
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MRPL4 Rabbit Polyclonal Antibody (orb586852) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
AAG02005
Preservative
Lyophilized powder
AA Sequence
YAKTKTRAEVRGGGRKPWPQKGTGRARHGSIRSPLWRGGGVAHGPRGPTS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GM-105-10 1 mL
Colloidal Gold Conjugated Monoclonal Antibody to Human IgA1, 10nm
Sign In for Pricing
View Details 
BNCB2207-500 1x 500 µL
HSP60 (Heat Shock Protein 60) (Mitochondrial Marker) (rGROEL/780), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC471648-100 1x 100 µL
TIMP1 (Marker of Lymph Node Metastasis) (2A5), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 