Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPL9 Peptide - C-terminal region

MRPL9 Peptide - C-terminal region

Product Specifications

Product Name Alternative

L9mt

UniProt

Q9BYD2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MRPL9 Rabbit Polyclonal Antibody (orb586853) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_113608

Preservative

Lyophilized powder

AA Sequence

EPITRWGEYWCEVTVNGLDTVRVPMSVVNFEKPKTKRYKYWLAQQAAKAM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cd34 Mouse Gene Knockout Kit (CRISPR)
KN502909 1 Kit

Cd34 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
n-Heptyl 4-hydroxybenzoate-d4
TRC-H283182-25MG 25 mg

n-Heptyl 4-hydroxybenzoate-d4

Sign In for Pricing
View Details
Beclin 1 (BECN1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3F3]
TA502527AM 100 µL

Beclin 1 (BECN1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3F3]

Sign In for Pricing
View Details
Human IL-2RB/CD122, C-His Tag (ECD)
HA210544-01 20 µg

Human IL-2RB/CD122, C-His Tag (ECD)

Sign In for Pricing
View Details
Human IL-2RB/CD122, C-His Tag (ECD)
HA210544-02 50 µg

Human IL-2RB/CD122, C-His Tag (ECD)

Sign In for Pricing
View Details
Human IL-2RB/CD122, C-His Tag (ECD)
HA210544-03 100 µg

Human IL-2RB/CD122, C-His Tag (ECD)

Sign In for Pricing
View Details