Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPL9 Peptide - C-terminal region

MRPL9 Peptide - C-terminal region

Product Specifications

Product Name Alternative

L9mt

UniProt

Q9BYD2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MRPL9 Rabbit Polyclonal Antibody (orb586853) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_113608

Preservative

Lyophilized powder

AA Sequence

EPITRWGEYWCEVTVNGLDTVRVPMSVVNFEKPKTKRYKYWLAQQAAKAM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

uLK2 (NM_014683) Human Over-expression Lysate
LY402363 100 µg

uLK2 (NM_014683) Human Over-expression Lysate

Sign In for Pricing
View Details
MAD2L1 binding protein (MAD2L1BP) (NM_001003690) Human Over-expression Lysate
LY400374 100 µg

MAD2L1 binding protein (MAD2L1BP) (NM_001003690) Human Over-expression Lysate

Sign In for Pricing
View Details
(E)-Benzyl Clomiphene
TRC-B575750-10MG 10 mg

(E)-Benzyl Clomiphene

Sign In for Pricing
View Details
Glyphosate-13C,15N
TRC-G765009-5MG 5 mg

Glyphosate-13C,15N

Sign In for Pricing
View Details
Cfap161 Mouse Gene Knockout Kit (CRISPR)
KN500122 1 Kit

Cfap161 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human NIPAL3 activation kit by CRISPRa
GA111434 1 Kit

Human NIPAL3 activation kit by CRISPRa

Sign In for Pricing
View Details