OR1A2 Peptide - C-terminal region
OR1A2 Peptide - C-terminal region
Product Specifications
Product Name Alternative
MGC119930, MGC119931, OR17-6
UniProt
Q9Y585
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with OR1A2 Rabbit Polyclonal Antibody (orb326677) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_036484
Preservative
Lyophilized powder
AA Sequence
YGTTMGMYFRPLTSYSPKDAVITVMYVAVTPALNPFIYSLRNWDMKAALQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![CTBP1-DT Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2C6]](https://cdn.genprice.uk/products/937/6868c34d994c49e6dc3f39ee/imageurl/ta503479am.webp)
TA503479AM 100 µL
CTBP1-DT Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2C6]
Sign In for Pricing
View Details 
AP20615PU-N 100 µg
IL2 Receptor beta (IL2RB) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details ![UBE2G2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4A12]](https://cdn.genprice.uk/products/937/6868c367994c49e6dc3f62a9/imageurl/ta505286am.webp)
TA505286AM 100 µL
UBE2G2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4A12]
Sign In for Pricing
View Details 
BNC040383-100 1x 100 µL
Cytokeratin 8 (K8/383), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 