Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR1A2 Peptide - C-terminal region

OR1A2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC119930, MGC119931, OR17-6

UniProt

Q9Y585

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR1A2 Rabbit Polyclonal Antibody (orb326677) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_036484

Preservative

Lyophilized powder

AA Sequence

YGTTMGMYFRPLTSYSPKDAVITVMYVAVTPALNPFIYSLRNWDMKAALQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CSPS (SULT1A3) Mouse Monoclonal Antibody [Clone ID: OTI3G5]
CF811313 100 µg

CSPS (SULT1A3) Mouse Monoclonal Antibody [Clone ID: OTI3G5]

Sign In for Pricing
View Details
Cathepsin L (CTSL) Mouse Monoclonal Antibody [Clone ID: OTI5C8]
CF812846 100 µg

Cathepsin L (CTSL) Mouse Monoclonal Antibody [Clone ID: OTI5C8]

Sign In for Pricing
View Details
NMDAR2A (GRIN2A) Rabbit Polyclonal Antibody
TA371140 100 µL

NMDAR2A (GRIN2A) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Urm1 Mouse Gene Knockout Kit (CRISPR)
KN518751 1 Kit

Urm1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
HypoGel® 400 Br
SP40011015001.5G 5 g

HypoGel® 400 Br

Sign In for Pricing
View Details
Human Antithrombin III, C-His Tag
HA210985-01 Inquire

Human Antithrombin III, C-His Tag

Sign In for Pricing
View Details