Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR51V1 Peptide - C-terminal region

OR51V1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR11-36, OR51A12

UniProt

Q9H2C8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR51V1 Rabbit Polyclonal Antibody (orb586869) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001004760

Preservative

Lyophilized powder

AA Sequence

YYALMLVICILLLDAILILFSYILILKSVLAVASQEERHKLFQTCISHIC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Kidney
CS809260 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
Human SCLY activation kit by CRISPRa
GA109863 1 Kit

Human SCLY activation kit by CRISPRa

Sign In for Pricing
View Details
2'-Phenylacetanilide
TRC-P319220-250MG 250 mg

2'-Phenylacetanilide

Sign In for Pricing
View Details
CBP Antibody
SPC-752D 100 µg

CBP Antibody

Sign In for Pricing
View Details
CD45 (PTPRC) (CD45RA) Mouse Monoclonal Antibody [Clone ID: MB1]
AM39020FC-N 100 Tests

CD45 (PTPRC) (CD45RA) Mouse Monoclonal Antibody [Clone ID: MB1]

Sign In for Pricing
View Details
Polystyrene A CHO
HA110006.100G 100 g

Polystyrene A CHO

Sign In for Pricing
View Details