Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR51V1 Peptide - C-terminal region

OR51V1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR11-36, OR51A12

UniProt

Q9H2C8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR51V1 Rabbit Polyclonal Antibody (orb586869) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001004760

Preservative

Lyophilized powder

AA Sequence

YYALMLVICILLLDAILILFSYILILKSVLAVASQEERHKLFQTCISHIC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATF7 Recombinant Rabbit Monoclonal Antibody [JJ2-072]
ET1701-31 100 µL

ATF7 Recombinant Rabbit Monoclonal Antibody [JJ2-072]

Sign In for Pricing
View Details
Cytokeratin 5/8 (C-50), CF405S conjugate, 0.1mg/mL
BNC040948-100 1x 100 µL

Cytokeratin 5/8 (C-50), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human LYPLA2 Protein (His Tag)
PKSH033332-01 10 µg

Recombinant Human LYPLA2 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human LYPLA2 Protein (His Tag)
PKSH033332-02 50 µg

Recombinant Human LYPLA2 Protein (His Tag)

Sign In for Pricing
View Details
Crude Cytisus sscoparius Lectin (Scotch broom) -CSA-
L-3200-100 100 mg

Crude Cytisus sscoparius Lectin (Scotch broom) -CSA-

Sign In for Pricing
View Details
Noscapine
TRC-N882000-5G 5 g

Noscapine

Sign In for Pricing
View Details