Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR52A5 Peptide - C-terminal region

OR52A5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR11-33

UniProt

Q9H2C5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR52A5 Rabbit Polyclonal Antibody (orb586872) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001005160

Preservative

Lyophilized powder

AA Sequence

SFFTHRFGSHIPPYIHILLSNLYLLVPPFLNPIVYGVKTKQIRDHIVKVF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TentaGel® MAP 8 branch
J2004.5G 5 g

TentaGel® MAP 8 branch

Sign In for Pricing
View Details
EpCAM Antibody
F46203-0.08ML 0.08 mL

EpCAM Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Endometrium
CS715872 5x 5 µm

Tissue FFPE Sections, Endometrium

Sign In for Pricing
View Details
Collagen V α1 Antibody
8C12201-AAT 50 µg

Collagen V α1 Antibody

Sign In for Pricing
View Details
Involucrin (SY5), CF488A conjugate, 0.1mg/mL
BNC880678-100 1x 100 µL

Involucrin (SY5), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Psg28 Mouse Gene Knockout Kit (CRISPR)
KN514085 1 Kit

Psg28 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details