Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OSGEPL1 Peptide - C-terminal region

OSGEPL1 Peptide - C-terminal region

Product Specifications

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OSGEPL1 Rabbit Polyclonal Antibody (orb586874) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_071748

Preservative

Lyophilized powder

AA Sequence

IMIAWNGIERLRAGLGILHDIEGIRYEPKCPLGVDISKEVGEASIKVPQL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Constitutive androstane receptor (NR1I3) (NM_001077469) Human Tagged ORF Clone
RG216643 10 µg

Constitutive androstane receptor (NR1I3) (NM_001077469) Human Tagged ORF Clone

Sign In for Pricing
View Details
Genorise® Biotinylated Canine Uteroglobin Polyclonal Antibody
GR109188 50 mg

Genorise® Biotinylated Canine Uteroglobin Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Mycobacterium Avium folD Protein (aa 1-281)
VAng-Yyj2535-500gEcoli 500 µg (E. coli)

Recombinant Mycobacterium Avium folD Protein (aa 1-281)

Sign In for Pricing
View Details
SIN3A Recombinant Antibody, AbBy Fluor™ 647 Conjugated
bsm-61578R-BF647-01 20 µL

SIN3A Recombinant Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
SIN3A Recombinant Antibody, AbBy Fluor™ 647 Conjugated
bsm-61578R-BF647-02 100 µL

SIN3A Recombinant Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
Rabbit anti-Aspartoacylase Antibody
DL96421A-01 50 µL

Rabbit anti-Aspartoacylase Antibody

Sign In for Pricing
View Details