PGPEP1 Peptide - N-terminal region
PGPEP1 Peptide - N-terminal region
Product Specifications
Product Name Alternative
FLJ20208, MGC10812, PGP, PGP-I, PGPI, Pcp
UniProt
Q9NXJ5
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PGPEP1 Rabbit Polyclonal Antibody (orb586879) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_060182
Preservative
Lyophilized powder
AA Sequence
KHSPQLVVHVGVSGMATTVTLEKCGHNKGYKGLDNCRFCPGSQCCVEDGP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
K1414808 1.0 µg DNA
NEDD7 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
Sign In for Pricing
View Details 
MR218111L4V 200 µL
Olfr18 (NM_146563) Mouse Tagged ORF Clone Lentiviral Particle
Sign In for Pricing
View Details 
GTR15390191 1 Vial
Lentiviral human TIPRL sgRNA gene knockout kit - Lentiviral human TIPRL sgRNA gene knockout kit (plasmid)
Sign In for Pricing
View Details 