Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PGPEP1 Peptide - N-terminal region

PGPEP1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ20208, MGC10812, PGP, PGP-I, PGPI, Pcp

UniProt

Q9NXJ5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PGPEP1 Rabbit Polyclonal Antibody (orb586879) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060182

Preservative

Lyophilized powder

AA Sequence

KHSPQLVVHVGVSGMATTVTLEKCGHNKGYKGLDNCRFCPGSQCCVEDGP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ING4 (NM_016162) Human Recombinant Protein
TP302827M 100 µg

ING4 (NM_016162) Human Recombinant Protein

Sign In for Pricing
View Details
Human KIAA1551 knockdown cell line
ABC-KD7869 1 Vial

Human KIAA1551 knockdown cell line

Sign In for Pricing
View Details
PerCP-Cy5.5 Anti-Mouse CD80 Antibody (16-10A1)
PCP55-30024U-01 25 µg

PerCP-Cy5.5 Anti-Mouse CD80 Antibody (16-10A1)

Sign In for Pricing
View Details
PerCP-Cy5.5 Anti-Mouse CD80 Antibody (16-10A1)
PCP55-30024U-02 100 µg

PerCP-Cy5.5 Anti-Mouse CD80 Antibody (16-10A1)

Sign In for Pricing
View Details
Fmoc-L-Lys (Dde) -OH
sc-294917 5 g

Fmoc-L-Lys (Dde) -OH

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Contactin Associated Protein 1 (CNTNAP1)
MBS2050687-01 0.1 mL

FITC-Linked Polyclonal Antibody to Contactin Associated Protein 1 (CNTNAP1)

Sign In for Pricing
View Details