Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLD5 Peptide - C-terminal region

PLD5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ40773, MGC120565, MGC120566, MGC120567, PLDC

UniProt

Q8N7P1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PLD5 Rabbit Polyclonal Antibody (orb586881) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001182741

Preservative

Lyophilized powder

AA Sequence

SSLKAICTEIANCSLKVKFFDLERENACATKEQKNHTFPRLNRNKYMVTD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RUVBL1, ID (RUVBL1, INO80H, NMP238, TIP49, TIP49A, RuvB-like 1, 49kD TATA box-binding protein-interacting protein, 54kD erythrocyte cytosolic protein, INO80 complex subunit H, Nuclear matrix protein 238, Pontin 52, TIP49a, TIP60-associated protein 54-alpha) (HRP) discontinued
041339-HRP 200 µL

RUVBL1, ID (RUVBL1, INO80H, NMP238, TIP49, TIP49A, RuvB-like 1, 49kD TATA box-binding protein-interacting protein, 54kD erythrocyte cytosolic protein, INO80 complex subunit H, Nuclear matrix protein 238, Pontin 52, TIP49a, TIP60-associated protein 54-alpha) (HRP) discontinued

Sign In for Pricing
View Details
HSP70 Recombinant Rabbit mAb, BF488 conjugated
orb1580398 100 µL

HSP70 Recombinant Rabbit mAb, BF488 conjugated

Sign In for Pricing
View Details
JAM-A Polyclonal Antibody
MBS8593147-01 0.1 mg

JAM-A Polyclonal Antibody

Sign In for Pricing
View Details
JAM-A Polyclonal Antibody
MBS8593147-02 0.1 mL (AF405L)

JAM-A Polyclonal Antibody

Sign In for Pricing
View Details
JAM-A Polyclonal Antibody
MBS8593147-03 0.1 mL (AF405S)

JAM-A Polyclonal Antibody

Sign In for Pricing
View Details
JAM-A Polyclonal Antibody
MBS8593147-04 0.1 mL (AF610)

JAM-A Polyclonal Antibody

Sign In for Pricing
View Details