Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLD5 Peptide - C-terminal region

PLD5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ40773, MGC120565, MGC120566, MGC120567, PLDC

UniProt

Q8N7P1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PLD5 Rabbit Polyclonal Antibody (orb586881) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001182741

Preservative

Lyophilized powder

AA Sequence

SSLKAICTEIANCSLKVKFFDLERENACATKEQKNHTFPRLNRNKYMVTD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr809 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
33461124 3x 1.0µg DNA

Olfr809 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
Mouse Annexin A8 (ANXA8) ELISA Kit
GTR10358002 96 Well

Mouse Annexin A8 (ANXA8) ELISA Kit

Sign In for Pricing
View Details
pCDH-CMV-BZW2-Myc-EF1a-Puro Plasmid
PVT40302 2 µg

pCDH-CMV-BZW2-Myc-EF1a-Puro Plasmid

Sign In for Pricing
View Details
IL-33 Rabbit mAb
A21068 100 µL

IL-33 Rabbit mAb

Sign In for Pricing
View Details
PTPN12 Antibody (HRP)
orb415714-01 50 µg

PTPN12 Antibody (HRP)

Sign In for Pricing
View Details
PTPN12 Antibody (HRP)
orb415714-02 100 µg

PTPN12 Antibody (HRP)

Sign In for Pricing
View Details