Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPM1L Peptide - middle region

PPM1L Peptide - middle region

Product Specifications

Product Name Alternative

MGC132545, MGC132547, PP2C-epsilon, PP2CE, PPM1-LIKE

UniProt

Q5SGD2

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PPM1L Rabbit Polyclonal Antibody (orb586884) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_640338

Preservative

Lyophilized powder

AA Sequence

SRLPEALKQHLQDYEKDKENSVLSYQTILEQQILSIDREMLEKLTVSYDE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P8 (NUPR1) (NM_012385) Human Recombinant Protein
PROTO60356 20 µg

P8 (NUPR1) (NM_012385) Human Recombinant Protein

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Complement Factor I (CFI)
MBS2061442-01 0.1 mL

HRP-Linked Polyclonal Antibody to Complement Factor I (CFI)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Complement Factor I (CFI)
MBS2061442-02 0.2 mL

HRP-Linked Polyclonal Antibody to Complement Factor I (CFI)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Complement Factor I (CFI)
MBS2061442-03 0.5 mL

HRP-Linked Polyclonal Antibody to Complement Factor I (CFI)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Complement Factor I (CFI)
MBS2061442-04 1 mL

HRP-Linked Polyclonal Antibody to Complement Factor I (CFI)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Complement Factor I (CFI)
MBS2061442-05 5 mL

HRP-Linked Polyclonal Antibody to Complement Factor I (CFI)

Sign In for Pricing
View Details