Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPM1L Peptide - middle region

PPM1L Peptide - middle region

Product Specifications

Product Name Alternative

MGC132545, MGC132547, PP2C-epsilon, PP2CE, PPM1-LIKE

UniProt

Q5SGD2

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PPM1L Rabbit Polyclonal Antibody (orb586884) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_640338

Preservative

Lyophilized powder

AA Sequence

SRLPEALKQHLQDYEKDKENSVLSYQTILEQQILSIDREMLEKLTVSYDE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

β-1,4-Gal-T4 CRISPR/Cas9 KO Plasmid (h)
sc-407251 20 µg

β-1,4-Gal-T4 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
Pttg1 Rat shRNA Lentiviral Particle (Locus ID 64193)
TL710686V 500 µL Each

Pttg1 Rat shRNA Lentiviral Particle (Locus ID 64193)

Sign In for Pricing
View Details
Pik3r2 3'UTR GFP Stable Cell Line
TU166381 1.0 mL

Pik3r2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Recombinant Human MB Protein, C-His
orb2832560-01 20 µg

Recombinant Human MB Protein, C-His

Sign In for Pricing
View Details
Recombinant Human MB Protein, C-His
orb2832560-02 50 µg

Recombinant Human MB Protein, C-His

Sign In for Pricing
View Details
Recombinant Human MB Protein, C-His
orb2832560-03 100 µg

Recombinant Human MB Protein, C-His

Sign In for Pricing
View Details