Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTCD1 Peptide - N-terminal region

PTCD1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

KIAA0632

UniProt

O75127

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PTCD1 Rabbit Polyclonal Antibody (orb586888) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_056360

Preservative

Lyophilized powder

AA Sequence

SQLPLGQERQENTGSLGSDPSHSNSTATQEEDEEEEESFGTLSDKYSSRR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zfp365 Protein Lysate (Mouse) with C-HA Tag
50937034 100 µg

Zfp365 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
Denatonium Benzoate 99+% discontinued. See 274145
446086-01 25 mg

Denatonium Benzoate 99+% discontinued. See 274145

Sign In for Pricing
View Details
Denatonium Benzoate 99+% discontinued. See 274145
446086-02 100 mg

Denatonium Benzoate 99+% discontinued. See 274145

Sign In for Pricing
View Details
Chicken G protein-coupled receptor 94 ELISA Kit
MBS753312-01 48 Well

Chicken G protein-coupled receptor 94 ELISA Kit

Sign In for Pricing
View Details
Chicken G protein-coupled receptor 94 ELISA Kit
MBS753312-02 96 Well

Chicken G protein-coupled receptor 94 ELISA Kit

Sign In for Pricing
View Details
Chicken G protein-coupled receptor 94 ELISA Kit
MBS753312-03 5x 96 Well

Chicken G protein-coupled receptor 94 ELISA Kit

Sign In for Pricing
View Details