Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLITRK4 Peptide - C-terminal region

SLITRK4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DKFZp547M2010

UniProt

Q8IW52

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLITRK4 Rabbit Polyclonal Antibody (orb586897) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_775101

Preservative

Lyophilized powder

AA Sequence

CGSMQLQLRKHDHKTNKKDGLSTEAFIPQTIEQMSKSHTCGLKESETGFM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) YDL012C Polyclonal Antibody
MBS7189898 Inquire

Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) YDL012C Polyclonal Antibody

Sign In for Pricing
View Details
pLV3-U6-DNASE1L3-shRNA1-Puro Plasmid
PVT54996 2 µg

pLV3-U6-DNASE1L3-shRNA1-Puro Plasmid

Sign In for Pricing
View Details
ZDHHC13 Antibody
29-988 100 µL

ZDHHC13 Antibody

Sign In for Pricing
View Details
Lamin A (MaxLight 490)
MBS6245465-01 0.1 mL

Lamin A (MaxLight 490)

Sign In for Pricing
View Details
Lamin A (MaxLight 490)
MBS6245465-02 5x 0.1 mL

Lamin A (MaxLight 490)

Sign In for Pricing
View Details
MS432 50mg
A23942-50 50 mg

MS432 50mg

Sign In for Pricing
View Details