Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLITRK4 Peptide - C-terminal region

SLITRK4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DKFZp547M2010

UniProt

Q8IW52

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLITRK4 Rabbit Polyclonal Antibody (orb586897) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_775101

Preservative

Lyophilized powder

AA Sequence

CGSMQLQLRKHDHKTNKKDGLSTEAFIPQTIEQMSKSHTCGLKESETGFM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AurkA allosteric-IN-1
HY-158038 1 Each

AurkA allosteric-IN-1

Sign In for Pricing
View Details
Mouse Neurofilament, Heavy Polypeptide ELISA Kit
MBS749646-01 48 Well

Mouse Neurofilament, Heavy Polypeptide ELISA Kit

Sign In for Pricing
View Details
Mouse Neurofilament, Heavy Polypeptide ELISA Kit
MBS749646-02 96 Well

Mouse Neurofilament, Heavy Polypeptide ELISA Kit

Sign In for Pricing
View Details
Mouse Neurofilament, Heavy Polypeptide ELISA Kit
MBS749646-03 5x 96 Well

Mouse Neurofilament, Heavy Polypeptide ELISA Kit

Sign In for Pricing
View Details
Mouse Neurofilament, Heavy Polypeptide ELISA Kit
MBS749646-04 10x 96 Well

Mouse Neurofilament, Heavy Polypeptide ELISA Kit

Sign In for Pricing
View Details
RAD51 Recombinant Protein
OPCD06576-10UG 10 µg

RAD51 Recombinant Protein

Sign In for Pricing
View Details