Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lsm10 Peptide - N-terminal region

Lsm10 Peptide - N-terminal region

Product Specifications

UniProt

B2RYU1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Lsm10 Rabbit Polyclonal Antibody (orb577885) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001102446

Preservative

Lyophilized powder

AA Sequence

MALSHSVKERTISENSLIILLQGLQGQITTVDLRDESVARGRIDNVDAFM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (CR2/1953), 0.2mg/mL
BNUB1953-100 1x 100 µL

CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (CR2/1953), 0.2mg/mL

Sign In for Pricing
View Details
High Binding 96 well plates - 8 Well Strips on 12 x 8 frame - White PS
MTW01F4-HB8 50x 96 Well Plates

High Binding 96 well plates - 8 Well Strips on 12 x 8 frame - White PS

Sign In for Pricing
View Details
Tissue FFPE Sections, Thyroid gland
CS708711 5x 5 µm

Tissue FFPE Sections, Thyroid gland

Sign In for Pricing
View Details
Polystyrene AM RAM
H40023.25G 25 g

Polystyrene AM RAM

Sign In for Pricing
View Details
CD21 (CR2) Mouse Monoclonal Antibody [Clone ID: OTI2A5]
CF814113 100 µg

CD21 (CR2) Mouse Monoclonal Antibody [Clone ID: OTI2A5]

Sign In for Pricing
View Details
Hex Recombinant Rabbit Monoclonal Antibody [JE37-45]
HA722753 100 µL

Hex Recombinant Rabbit Monoclonal Antibody [JE37-45]

Sign In for Pricing
View Details