Lsm10 Peptide - N-terminal region
Lsm10 Peptide - N-terminal region
Product Specifications
UniProt
B2RYU1
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Lsm10 Rabbit Polyclonal Antibody (orb577885) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001102446
Preservative
Lyophilized powder
AA Sequence
MALSHSVKERTISENSLIILLQGLQGQITTVDLRDESVARGRIDNVDAFM
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470756-100 1x 100 µL
Neurofilament (H+L) (NF421 + NFL736), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNCB1850-500 1x 500 µL
PD-L2 / PDCD1LG2 / CD273 (PDL2/1850), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNCB3132-500 1x 500 µL
GLUT-1 (Tumor Progression and Mesothelioma Marker) (GLUT1/3132R), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![NR1D2 Mouse Monoclonal Antibody [Clone ID: OTI5E10]](https://cdn.genprice.uk/products/937/68dd18b9061270361e907edc/imageurl/cf806365.webp)
CF806365 100 µg
NR1D2 Mouse Monoclonal Antibody [Clone ID: OTI5E10]
Sign In for Pricing
View Details