What is the catalog number for Pten Peptide - N-terminal region?

The catalog number for Pten Peptide - N-terminal region is orb2006452.

What sizes are available for Pten Peptide - N-terminal region?

Pten Peptide - N-terminal region is available in the following size(s): 100 µg.

Is Pten Peptide - N-terminal region in stock?

Pten Peptide - N-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

Pten Peptide - N-terminal region

Product Specifications

Product Name Alternative

2310035O07Rik, A130070J02Rik, AI463227, B430203M17Rik, MMAC1, TEP1

UniProt

O08586

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_032986

Preservative

Lyophilized powder

AA Sequence

IIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

sc-403229 20 µg

Netrin-4 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing

View Details

CS-O-57090 1 Each

N-Nitroso Elacestrant-S-isomer

Sign In for Pricing

View Details

BNUB2197-100 1x 100 µL

HCG-beta (Pregnancy & Choriocarcinoma Marker) (rHCGb/54), 0.2mg/mL

Sign In for Pricing

View Details

T82526-01 5 mg

Drotrecogin alfa (activated)

Sign In for Pricing

View Details

T82526-02 50 mg

Drotrecogin alfa (activated)

Sign In for Pricing

View Details

bs-42227R-BF647 100 µL

RANK Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing

View Details