Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pten Peptide - N-terminal region

Pten Peptide - N-terminal region

Product Specifications

Product Name Alternative

2310035O07Rik, A130070J02Rik, AI463227, B430203M17Rik, MMAC1, TEP1

UniProt

O08586

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_032986

Preservative

Lyophilized powder

AA Sequence

IIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DHRSX Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV791443 1.0 µg DNA

DHRSX Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
HES4 CRISPR/Cas9 KO Plasmid (h)
sc-408938 20 µg

HES4 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
COL12A1 Antibody
MBS7001068-01 0.05 mg

COL12A1 Antibody

Sign In for Pricing
View Details
COL12A1 Antibody
MBS7001068-02 0.1 mg

COL12A1 Antibody

Sign In for Pricing
View Details
COL12A1 Antibody
MBS7001068-03 5x 0.1 mg

COL12A1 Antibody

Sign In for Pricing
View Details
MIR4672 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV769808 1.0 µg DNA

MIR4672 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details