Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Creld1 Peptide - middle region

Creld1 Peptide - middle region

Product Specifications

Product Name Alternative

AI843811

UniProt

Q91XD7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Creld1 Rabbit Polyclonal Antibody (orb579361) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_598691

Preservative

Lyophilized powder

AA Sequence

ACGQCGLGYFEAERNSSHLVCSACFGPCARCTGPEESHCLQCKKGWALHH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Human LPCAT4 pAb
PA7927-01 50 μL

Rabbit Anti-Human LPCAT4 pAb

Sign In for Pricing
View Details
Rabbit Anti-Human LPCAT4 pAb
PA7927-02 100 μL

Rabbit Anti-Human LPCAT4 pAb

Sign In for Pricing
View Details
Tween 20
EC-607-01 200 mL

Tween 20

Sign In for Pricing
View Details
Tween 20
EC-607-02 1 L

Tween 20

Sign In for Pricing
View Details
CTSK (ID R222) (Cathepsin K, Cathepsin O, Cathepsin X, Cathepsin O2, CTSO2, CTSO) (MaxLight 550)
MBS6467726-01 0.1 mL

CTSK (ID R222) (Cathepsin K, Cathepsin O, Cathepsin X, Cathepsin O2, CTSO2, CTSO) (MaxLight 550)

Sign In for Pricing
View Details
CTSK (ID R222) (Cathepsin K, Cathepsin O, Cathepsin X, Cathepsin O2, CTSO2, CTSO) (MaxLight 550)
MBS6467726-02 5x 0.1 mL

CTSK (ID R222) (Cathepsin K, Cathepsin O, Cathepsin X, Cathepsin O2, CTSO2, CTSO) (MaxLight 550)

Sign In for Pricing
View Details