Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Aqp8 Peptide - middle region

Aqp8 Peptide - middle region

Product Specifications

Product Name Alternative

AQP-8

UniProt

P56405

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Aqp8 Rabbit Polyclonal Antibody (orb579379) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_062031

Preservative

Lyophilized powder

AA Sequence

VTLVGGLKTMLLIPYWVSQLFGGMIGAALAKVVSPEERFWNASGAAFAIV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TXNDC9 AAV Vector (Mouse) (CMV)
48878104 1 µg

TXNDC9 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
PARN Peptide
MBS3228538-01 0.1 mg

PARN Peptide

Sign In for Pricing
View Details
PARN Peptide
MBS3228538-02 5x 0.1 mg

PARN Peptide

Sign In for Pricing
View Details
Boc-D-Tyr (Br-Z)
2612-01 1 g

Boc-D-Tyr (Br-Z)

Sign In for Pricing
View Details
Boc-D-Tyr (Br-Z)
2612-02 5 g

Boc-D-Tyr (Br-Z)

Sign In for Pricing
View Details
Jub sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K6979907 1.0 µg DNA

Jub sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details