Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Aqp8 Peptide - middle region

Aqp8 Peptide - middle region

Product Specifications

Product Name Alternative

AQP-8

UniProt

P56405

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Aqp8 Rabbit Polyclonal Antibody (orb579379) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_062031

Preservative

Lyophilized powder

AA Sequence

VTLVGGLKTMLLIPYWVSQLFGGMIGAALAKVVSPEERFWNASGAAFAIV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Calcitonin Gene Related Peptide (CGRP)
SIPA479Ra01-01 10 µg

Recombinant Calcitonin Gene Related Peptide (CGRP)

Sign In for Pricing
View Details
Recombinant Calcitonin Gene Related Peptide (CGRP)
SIPA479Ra01-02 50 µg

Recombinant Calcitonin Gene Related Peptide (CGRP)

Sign In for Pricing
View Details
Recombinant Calcitonin Gene Related Peptide (CGRP)
SIPA479Ra01-03 200 µg

Recombinant Calcitonin Gene Related Peptide (CGRP)

Sign In for Pricing
View Details
Recombinant Calcitonin Gene Related Peptide (CGRP)
SIPA479Ra01-04 1 mg

Recombinant Calcitonin Gene Related Peptide (CGRP)

Sign In for Pricing
View Details
Recombinant Calcitonin Gene Related Peptide (CGRP)
SIPA479Ra01-05 5 mg

Recombinant Calcitonin Gene Related Peptide (CGRP)

Sign In for Pricing
View Details
AGS8830-8 PCR instrument
AGS8830 1 unit/set

AGS8830-8 PCR instrument

Sign In for Pricing
View Details