Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Galnt2 Peptide - C-terminal region

Galnt2 Peptide - C-terminal region

Product Specifications

UniProt

D3ZFD2

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Galnt2 Rabbit Polyclonal Antibody (orb579795) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001099666

Preservative

Lyophilized powder

AA Sequence

DRSPGSLIRLQGCRENDSRQKWEQIEGNSKLRHVGSNLCLDSRTAKSGGL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Naglt1c siRNA (m)
sc-149802 10 µM

Naglt1c siRNA (m)

Sign In for Pricing
View Details
KCNG3 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)
LV682536 1.0 µg DNA

KCNG3 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
FAK (FAK1, Focal adhesion kinase 1, PTK2 protein tyrosine kinase 2)
030211 100 µL

FAK (FAK1, Focal adhesion kinase 1, PTK2 protein tyrosine kinase 2)

Sign In for Pricing
View Details
HIF-1Beta Polyclonal Antibody
ABP51514-01 30 µL

HIF-1Beta Polyclonal Antibody

Sign In for Pricing
View Details
HIF-1Beta Polyclonal Antibody
ABP51514-02 100 µL

HIF-1Beta Polyclonal Antibody

Sign In for Pricing
View Details
HIF-1Beta Polyclonal Antibody
ABP51514-03 200 µL

HIF-1Beta Polyclonal Antibody

Sign In for Pricing
View Details