Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Galnt2 Peptide - C-terminal region

Galnt2 Peptide - C-terminal region

Product Specifications

UniProt

D3ZFD2

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Galnt2 Rabbit Polyclonal Antibody (orb579795) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001099666

Preservative

Lyophilized powder

AA Sequence

DRSPGSLIRLQGCRENDSRQKWEQIEGNSKLRHVGSNLCLDSRTAKSGGL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sphingomyelin Quantification Colorimetric Assay Kit
K600-100 100 Assays

Sphingomyelin Quantification Colorimetric Assay Kit

Sign In for Pricing
View Details
HVCN1 Human Pre-designed siRNA Set A
HY-RS06494 1 Set

HVCN1 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
IGFBP7 Monoclonal Antibody
BT-MCA3780-01 50 µL

IGFBP7 Monoclonal Antibody

Sign In for Pricing
View Details
IGFBP7 Monoclonal Antibody
BT-MCA3780-02 100 µL

IGFBP7 Monoclonal Antibody

Sign In for Pricing
View Details
Apolipoprotein CI (APOC1) (NM_001645) Human Recombinant Protein
PH37895M5 20 µg

Apolipoprotein CI (APOC1) (NM_001645) Human Recombinant Protein

Sign In for Pricing
View Details
(R) -2- ((tert-Butoxycarbonyl) amino) -3- (2,4-dichlorophenyl) propanoic acid
OR73955-01 250 mg

(R) -2- ((tert-Butoxycarbonyl) amino) -3- (2,4-dichlorophenyl) propanoic acid

Sign In for Pricing
View Details