Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hsd17b12 Peptide - C-terminal region

Hsd17b12 Peptide - C-terminal region

Product Specifications

Product Name Alternative

2610510O05Rik, AI172963, KIK-I, Kik1

UniProt

O70503

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Hsd17b12 Rabbit Polyclonal Antibody (orb579989) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_062631

Preservative

Lyophilized powder

AA Sequence

SAETFVKSAIKTVGLQTRTTGYVIHSLMGSINSIMPRWMYFKIIMGFSKS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Transforming Growth Factor Beta 3 (TGFb3) Protein
abx655844-01 50 µg

Human Transforming Growth Factor Beta 3 (TGFb3) Protein

Sign In for Pricing
View Details
Human Transforming Growth Factor Beta 3 (TGFb3) Protein
abx655844-02 100 µg

Human Transforming Growth Factor Beta 3 (TGFb3) Protein

Sign In for Pricing
View Details
Human Transforming Growth Factor Beta 3 (TGFb3) Protein
abx655844-03 200 µg

Human Transforming Growth Factor Beta 3 (TGFb3) Protein

Sign In for Pricing
View Details
Human Transforming Growth Factor Beta 3 (TGFb3) Protein
abx655844-04 500 µg

Human Transforming Growth Factor Beta 3 (TGFb3) Protein

Sign In for Pricing
View Details
Human Transforming Growth Factor Beta 3 (TGFb3) Protein
abx655844-05 1 mg

Human Transforming Growth Factor Beta 3 (TGFb3) Protein

Sign In for Pricing
View Details
Human Lipophilin B, Prostatein Like (LIPB) ELISA Kit
DLR-LIPB-Hu-48T 48 Tests

Human Lipophilin B, Prostatein Like (LIPB) ELISA Kit

Sign In for Pricing
View Details